Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for Galaxie 21. Galaxie Lv 1 63 pts. 9,510
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 62 pts. 9,508
  3. Avatar for toshiue 23. toshiue Lv 1 60 pts. 9,507
  4. Avatar for Blipperman 24. Blipperman Lv 1 59 pts. 9,492
  5. Avatar for reefyrob 25. reefyrob Lv 1 58 pts. 9,482
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 56 pts. 9,482
  7. Avatar for cinnamonkitty 27. cinnamonkitty Lv 1 55 pts. 9,476
  8. Avatar for mimi 28. mimi Lv 1 53 pts. 9,471
  9. Avatar for retiredmichael 29. retiredmichael Lv 1 52 pts. 9,464
  10. Avatar for grogar7 30. grogar7 Lv 1 51 pts. 9,444

Comments