Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,413
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,370
  3. Avatar for freefolder 14. freefolder 1 pt. 7,874
  4. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,609
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 4,372

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,759
  2. Avatar for gitwut 2. gitwut Lv 1 97 pts. 9,647
  3. Avatar for bertro 3. bertro Lv 1 94 pts. 9,593
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 91 pts. 9,574
  5. Avatar for tokens 5. tokens Lv 1 89 pts. 9,573
  6. Avatar for Galaxie 6. Galaxie Lv 1 86 pts. 9,568
  7. Avatar for reefyrob 7. reefyrob Lv 1 83 pts. 9,543
  8. Avatar for smilingone 8. smilingone Lv 1 80 pts. 9,515
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 78 pts. 9,502
  10. Avatar for Deleted player 10. Deleted player pts. 9,462

Comments