Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,413
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,370
  3. Avatar for freefolder 14. freefolder 1 pt. 7,874
  4. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,609
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 4,372

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,632
  2. Avatar for georg137 2. georg137 Lv 1 87 pts. 9,627
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 74 pts. 9,621
  4. Avatar for mimi 4. mimi Lv 1 64 pts. 9,613
  5. Avatar for LociOiling 6. LociOiling Lv 1 46 pts. 9,602
  6. Avatar for smilingone 7. smilingone Lv 1 38 pts. 9,602
  7. Avatar for reefyrob 8. reefyrob Lv 1 32 pts. 9,591
  8. Avatar for Galaxie 9. Galaxie Lv 1 27 pts. 9,580
  9. Avatar for retiredmichael 10. retiredmichael Lv 1 22 pts. 9,580

Comments