Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for gmn 11. gmn Lv 1 18 pts. 9,570
  2. Avatar for lamoille 12. lamoille Lv 1 15 pts. 9,568
  3. Avatar for Hollinas 13. Hollinas Lv 1 12 pts. 9,555
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 9 pts. 9,551
  5. Avatar for JayD7217 15. JayD7217 Lv 1 8 pts. 9,547
  6. Avatar for Deleted player 16. Deleted player pts. 9,546
  7. Avatar for hansvandenhof 17. hansvandenhof Lv 1 5 pts. 9,544
  8. Avatar for jamiexq 18. jamiexq Lv 1 4 pts. 9,541
  9. Avatar for phi16 19. phi16 Lv 1 3 pts. 9,541
  10. Avatar for alwen 20. alwen Lv 1 2 pts. 9,537

Comments