Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,759
  2. Avatar for gitwut 2. gitwut Lv 1 97 pts. 9,647
  3. Avatar for bertro 3. bertro Lv 1 94 pts. 9,593
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 91 pts. 9,574
  5. Avatar for tokens 5. tokens Lv 1 89 pts. 9,573
  6. Avatar for Galaxie 6. Galaxie Lv 1 86 pts. 9,568
  7. Avatar for reefyrob 7. reefyrob Lv 1 83 pts. 9,543
  8. Avatar for smilingone 8. smilingone Lv 1 80 pts. 9,515
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 78 pts. 9,502
  10. Avatar for Deleted player 10. Deleted player pts. 9,462

Comments