Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for Glen B 21. Glen B Lv 1 52 pts. 9,306
  2. Avatar for shettler 22. shettler Lv 1 50 pts. 9,304
  3. Avatar for Museka 23. Museka Lv 1 48 pts. 9,299
  4. Avatar for TomTaylor 24. TomTaylor Lv 1 47 pts. 9,296
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 45 pts. 9,288
  6. Avatar for hansvandenhof 26. hansvandenhof Lv 1 43 pts. 9,286
  7. Avatar for LociOiling 27. LociOiling Lv 1 42 pts. 9,275
  8. Avatar for Deleted player 28. Deleted player pts. 9,264
  9. Avatar for Vinara 29. Vinara Lv 1 39 pts. 9,259
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 37 pts. 9,256

Comments