Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for kabubi 31. kabubi Lv 1 36 pts. 9,254
  2. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 33 pts. 9,222
  3. Avatar for georg137 34. georg137 Lv 1 32 pts. 9,220
  4. Avatar for Skippysk8s 35. Skippysk8s Lv 1 31 pts. 9,216
  5. Avatar for pauldunn 36. pauldunn Lv 1 30 pts. 9,215
  6. Avatar for Bruno Kestemont 37. Bruno Kestemont Lv 1 28 pts. 9,213
  7. Avatar for gmn 38. gmn Lv 1 27 pts. 9,204
  8. Avatar for Bautho 39. Bautho Lv 1 26 pts. 9,204
  9. Avatar for phi16 40. phi16 Lv 1 25 pts. 9,201

Comments