Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for phi16 91. phi16 Lv 1 3 pts. 8,745
  2. Avatar for uihcv 92. uihcv Lv 1 3 pts. 8,744
  3. Avatar for pellegrinipaol 93. pellegrinipaol Lv 1 3 pts. 8,735
  4. Avatar for harvardman 94. harvardman Lv 1 3 pts. 8,640
  5. Avatar for joaniegirl 95. joaniegirl Lv 1 3 pts. 8,610
  6. Avatar for SouperGenious 96. SouperGenious Lv 1 2 pts. 8,534
  7. Avatar for gdnskye 97. gdnskye Lv 1 2 pts. 8,527
  8. Avatar for JUMELLE54 98. JUMELLE54 Lv 1 2 pts. 8,459
  9. Avatar for bitwave 99. bitwave Lv 1 2 pts. 8,443
  10. Avatar for Simek 100. Simek Lv 1 2 pts. 8,439

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN