Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for Scopper 101. Scopper Lv 1 2 pts. 8,423
  2. Avatar for hada 102. hada Lv 1 2 pts. 8,382
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 2 pts. 8,374
  4. Avatar for javatlacati 104. javatlacati Lv 1 2 pts. 8,365
  5. Avatar for DScott 105. DScott Lv 1 2 pts. 8,356
  6. Avatar for Fat Tony 106. Fat Tony Lv 1 1 pt. 8,347
  7. Avatar for Mike Cassidy 107. Mike Cassidy Lv 1 1 pt. 8,300
  8. Avatar for khendarg 108. khendarg Lv 1 1 pt. 8,294
  9. Avatar for senor pit 109. senor pit Lv 1 1 pt. 8,284
  10. Avatar for pandapharmd 110. pandapharmd Lv 1 1 pt. 8,253

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN