Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for Imeturoran 111. Imeturoran Lv 1 1 pt. 8,225
  2. Avatar for rezaefar 112. rezaefar Lv 1 1 pt. 8,217
  3. Avatar for Iron pet 113. Iron pet Lv 1 1 pt. 8,205
  4. Avatar for fishercat 114. fishercat Lv 1 1 pt. 8,167
  5. Avatar for tweak64 115. tweak64 Lv 1 1 pt. 8,165
  6. Avatar for jebbiek 116. jebbiek Lv 1 1 pt. 8,142
  7. Avatar for FishKAA 117. FishKAA Lv 1 1 pt. 8,135
  8. Avatar for navn 118. navn Lv 1 1 pt. 8,108
  9. Avatar for rinze 119. rinze Lv 1 1 pt. 8,089
  10. Avatar for kvasirthewise 120. kvasirthewise Lv 1 1 pt. 8,079

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN