Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for leehaggis 121. leehaggis Lv 1 1 pt. 8,072
  2. Avatar for tscherulli 122. tscherulli Lv 1 1 pt. 8,059
  3. Avatar for Jim Fraser 123. Jim Fraser Lv 1 1 pt. 8,053
  4. Avatar for Cerzax 124. Cerzax Lv 1 1 pt. 8,036
  5. Avatar for Threeoak 125. Threeoak Lv 1 1 pt. 8,008
  6. Avatar for Superphosphate 126. Superphosphate Lv 1 1 pt. 7,986
  7. Avatar for stephen.r.lewis86 127. stephen.r.lewis86 Lv 1 1 pt. 7,978
  8. Avatar for momadoc 128. momadoc Lv 1 1 pt. 7,967
  9. Avatar for Ariasmpony 129. Ariasmpony Lv 1 1 pt. 7,941
  10. Avatar for byewelt 130. byewelt Lv 1 1 pt. 7,936

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN