Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for parsnip 141. parsnip Lv 1 1 pt. 7,679
  2. Avatar for citric acid 142. citric acid Lv 1 1 pt. 7,675
  3. Avatar for kiki233 143. kiki233 Lv 1 1 pt. 7,668
  4. Avatar for Brainiac_2017 144. Brainiac_2017 Lv 1 1 pt. 7,630
  5. Avatar for mirjamvandelft 145. mirjamvandelft Lv 1 1 pt. 7,613
  6. Avatar for trentis1 146. trentis1 Lv 1 1 pt. 7,603
  7. Avatar for ZiiONIC 147. ZiiONIC Lv 1 1 pt. 7,601
  8. Avatar for SurgicalMaster 148. SurgicalMaster Lv 1 1 pt. 7,596
  9. Avatar for DamnitCats 149. DamnitCats Lv 1 1 pt. 7,595
  10. Avatar for sor2018 150. sor2018 Lv 1 1 pt. 7,589

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN