Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for jarbolol15 151. jarbolol15 Lv 1 1 pt. 7,562
  2. Avatar for xrossy03 152. xrossy03 Lv 1 1 pt. 7,545
  3. Avatar for .sr 153. .sr Lv 1 1 pt. 7,545
  4. Avatar for NotJim99 154. NotJim99 Lv 1 1 pt. 7,540
  5. Avatar for Marvelz 155. Marvelz Lv 1 1 pt. 7,518
  6. Avatar for 01010011111 156. 01010011111 Lv 1 1 pt. 7,481
  7. Avatar for Gleb Ptitsyn 157. Gleb Ptitsyn Lv 1 1 pt. 7,464
  8. Avatar for Leo_98 158. Leo_98 Lv 1 1 pt. 7,444
  9. Avatar for cjreinholt 159. cjreinholt Lv 1 1 pt. 7,444
  10. Avatar for haabermaaster 160. haabermaaster Lv 1 1 pt. 7,436

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN