Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for Galaxie 21. Galaxie Lv 1 55 pts. 9,505
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 53 pts. 9,504
  3. Avatar for pauldunn 23. pauldunn Lv 1 51 pts. 9,498
  4. Avatar for gmn 24. gmn Lv 1 50 pts. 9,497
  5. Avatar for frood66 25. frood66 Lv 1 48 pts. 9,493
  6. Avatar for joremen 26. joremen Lv 1 47 pts. 9,491
  7. Avatar for Deleted player 27. Deleted player pts. 9,489
  8. Avatar for tokens 28. tokens Lv 1 44 pts. 9,481
  9. Avatar for tarimo 29. tarimo Lv 1 42 pts. 9,459
  10. Avatar for hpaege 30. hpaege Lv 1 41 pts. 9,456

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN