Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for actiasluna 31. actiasluna Lv 1 39 pts. 9,450
  2. Avatar for georg137 32. georg137 Lv 1 38 pts. 9,448
  3. Avatar for kabubi 33. kabubi Lv 1 37 pts. 9,446
  4. Avatar for pvc78 34. pvc78 Lv 1 35 pts. 9,440
  5. Avatar for YeshuaLives 35. YeshuaLives Lv 1 34 pts. 9,436
  6. Avatar for Paulo Roque 36. Paulo Roque Lv 1 33 pts. 9,435
  7. Avatar for Norrjane 37. Norrjane Lv 1 32 pts. 9,425
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 31 pts. 9,420
  9. Avatar for MicElephant 39. MicElephant Lv 1 30 pts. 9,395
  10. Avatar for Blipperman 40. Blipperman Lv 1 29 pts. 9,387

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN