Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for Keresto 41. Keresto Lv 1 28 pts. 9,379
  2. Avatar for jamiexq 42. jamiexq Lv 1 27 pts. 9,366
  3. Avatar for Glen B 43. Glen B Lv 1 26 pts. 9,358
  4. Avatar for eromana 44. eromana Lv 1 25 pts. 9,317
  5. Avatar for shettler 45. shettler Lv 1 24 pts. 9,314
  6. Avatar for isaksson 46. isaksson Lv 1 23 pts. 9,307
  7. Avatar for Vinara 47. Vinara Lv 1 22 pts. 9,307
  8. Avatar for Vredeman 48. Vredeman Lv 1 21 pts. 9,301
  9. Avatar for eusair 49. eusair Lv 1 20 pts. 9,292
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 20 pts. 9,287

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN