Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for TomTaylor 51. TomTaylor Lv 1 19 pts. 9,272
  2. Avatar for caglar 52. caglar Lv 1 18 pts. 9,253
  3. Avatar for jermainiac 53. jermainiac Lv 1 17 pts. 9,253
  4. Avatar for tallguy-13088 54. tallguy-13088 Lv 1 17 pts. 9,252
  5. Avatar for jobo0502 55. jobo0502 Lv 1 16 pts. 9,251
  6. Avatar for diamonddays 56. diamonddays Lv 1 15 pts. 9,245
  7. Avatar for alwen 57. alwen Lv 1 15 pts. 9,244
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 14 pts. 9,243
  9. Avatar for dbuske 59. dbuske Lv 1 14 pts. 9,237
  10. Avatar for deLaCeiba 60. deLaCeiba Lv 1 13 pts. 9,230

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN