Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for guineapig 61. guineapig Lv 1 13 pts. 9,206
  2. Avatar for hansvandenhof 62. hansvandenhof Lv 1 12 pts. 9,205
  3. Avatar for alcor29 63. alcor29 Lv 1 12 pts. 9,204
  4. Avatar for gurch 64. gurch Lv 1 11 pts. 9,190
  5. Avatar for cbwest 65. cbwest Lv 1 11 pts. 9,141
  6. Avatar for JayD7217 66. JayD7217 Lv 1 10 pts. 9,135
  7. Avatar for stomjoh 67. stomjoh Lv 1 10 pts. 9,125
  8. Avatar for Bushman 68. Bushman Lv 1 9 pts. 9,118
  9. Avatar for grogar7 69. grogar7 Lv 1 9 pts. 9,099
  10. Avatar for johngran 70. johngran Lv 1 9 pts. 9,088

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN