Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for pfirth 71. pfirth Lv 1 8 pts. 9,082
  2. Avatar for Deleted player 72. Deleted player pts. 9,081
  3. Avatar for weitzen 73. weitzen Lv 1 7 pts. 9,079
  4. Avatar for snakeguy 74. snakeguy Lv 1 7 pts. 9,070
  5. Avatar for SKSbell 75. SKSbell Lv 1 7 pts. 9,060
  6. Avatar for cobaltteal 76. cobaltteal Lv 1 6 pts. 9,045
  7. Avatar for demeter900 77. demeter900 Lv 1 6 pts. 9,031
  8. Avatar for drumpeter18yrs9yrs 78. drumpeter18yrs9yrs Lv 1 6 pts. 9,020
  9. Avatar for Deleted player 79. Deleted player pts. 9,018
  10. Avatar for NinjaGreg 80. NinjaGreg Lv 1 5 pts. 9,009

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN