Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for cinnamonkitty 81. cinnamonkitty Lv 1 5 pts. 9,008
  2. Avatar for randomlil 82. randomlil Lv 1 5 pts. 8,992
  3. Avatar for mimi 83. mimi Lv 1 5 pts. 8,900
  4. Avatar for fryguy 84. fryguy Lv 1 4 pts. 8,891
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 4 pts. 8,832
  6. Avatar for mitarcher 86. mitarcher Lv 1 4 pts. 8,795
  7. Avatar for Ikuso 87. Ikuso Lv 1 4 pts. 8,793
  8. Avatar for Merf 88. Merf Lv 1 4 pts. 8,763
  9. Avatar for heyubob 89. heyubob Lv 1 3 pts. 8,750
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 3 pts. 8,747

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN