Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891
  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,621
  2. Avatar for smilingone 2. smilingone Lv 1 84 pts. 9,621
  3. Avatar for LociOiling 3. LociOiling Lv 1 70 pts. 9,620
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 58 pts. 9,608
  5. Avatar for Galaxie 5. Galaxie Lv 1 48 pts. 9,599
  6. Avatar for lamoille 6. lamoille Lv 1 39 pts. 9,598
  7. Avatar for georg137 7. georg137 Lv 1 32 pts. 9,596
  8. Avatar for jermainiac 8. jermainiac Lv 1 26 pts. 9,585
  9. Avatar for phi16 9. phi16 Lv 1 20 pts. 9,583
  10. Avatar for Deleted player 10. Deleted player pts. 9,583

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN