Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Contenders 100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891

  1. Avatar for pmdpmd 11. pmdpmd Lv 1 75 pts. 9,558
  2. Avatar for dembones 12. dembones Lv 1 73 pts. 9,550
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 70 pts. 9,544
  4. Avatar for nicobul 14. nicobul Lv 1 68 pts. 9,541
  5. Avatar for bertro 15. bertro Lv 1 66 pts. 9,540
  6. Avatar for crpainter 16. crpainter Lv 1 64 pts. 9,532
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 62 pts. 9,524
  8. Avatar for smilingone 18. smilingone Lv 1 60 pts. 9,523
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 58 pts. 9,521
  10. Avatar for Deleted player 20. Deleted player pts. 9,518

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN