Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,723
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,248
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 7,223
  4. Avatar for Deleted group 14. Deleted group pts. 7,124
  5. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,396
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,439
  2. Avatar for caglar 2. caglar Lv 1 98 pts. 9,409
  3. Avatar for Susume 3. Susume Lv 1 95 pts. 9,393
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 92 pts. 9,381
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 9,370
  6. Avatar for gitwut 6. gitwut Lv 1 87 pts. 9,356
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 84 pts. 9,350
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 82 pts. 9,349
  9. Avatar for Deleted player 9. Deleted player pts. 9,349
  10. Avatar for Vredeman 10. Vredeman Lv 1 77 pts. 9,345

Comments