Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913

  1. Avatar for Skippysk8s
    1. Skippysk8s Lv 1
    100 pts. 9,451
  2. Avatar for actiasluna 2. actiasluna Lv 1 88 pts. 9,451
  3. Avatar for Fat Tony 3. Fat Tony Lv 1 77 pts. 9,449
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 68 pts. 9,447
  5. Avatar for Blipperman 5. Blipperman Lv 1 59 pts. 9,437
  6. Avatar for Keresto 6. Keresto Lv 1 51 pts. 9,434
  7. Avatar for SaraL 7. SaraL Lv 1 44 pts. 9,432
  8. Avatar for Deleted player 8. Deleted player pts. 9,413
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 32 pts. 9,412
  10. Avatar for Hollinas 10. Hollinas Lv 1 27 pts. 9,410

Comments