Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 3 pts. 9,355
  2. Avatar for nicobul 22. nicobul Lv 1 3 pts. 9,352
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 2 pts. 9,352
  4. Avatar for alcor29 24. alcor29 Lv 1 2 pts. 9,352
  5. Avatar for gitwut 25. gitwut Lv 1 1 pt. 9,347
  6. Avatar for georg137 26. georg137 Lv 1 1 pt. 9,338
  7. Avatar for tokens 27. tokens Lv 1 1 pt. 9,338
  8. Avatar for gdnskye 28. gdnskye Lv 1 1 pt. 9,326
  9. Avatar for Deleted player 29. Deleted player pts. 9,326
  10. Avatar for mimi 30. mimi Lv 1 1 pt. 9,322

Comments