Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913
  1. Avatar for CharlieFortsConscience 31. CharlieFortsConscience Lv 1 1 pt. 9,321
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 1 pt. 9,287
  3. Avatar for Museka 33. Museka Lv 1 1 pt. 9,285
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 1 pt. 9,283
  5. Avatar for TomTaylor 35. TomTaylor Lv 1 1 pt. 9,260
  6. Avatar for jobo0502 36. jobo0502 Lv 1 1 pt. 9,108
  7. Avatar for ViJay7019 37. ViJay7019 Lv 1 1 pt. 9,100
  8. Avatar for jermainiac 38. jermainiac Lv 1 1 pt. 8,970
  9. Avatar for dbuske 39. dbuske Lv 1 1 pt. 8,789
  10. Avatar for harvardman 40. harvardman Lv 1 1 pt. 8,447

Comments