Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913
  1. Avatar for ripples2288 131. ripples2288 Lv 1 1 pt. 8,106
  2. Avatar for heyubob 132. heyubob Lv 1 1 pt. 8,051
  3. Avatar for demeter900 133. demeter900 Lv 1 1 pt. 7,886
  4. Avatar for ivanriddle 134. ivanriddle Lv 1 1 pt. 7,823
  5. Avatar for jackie123 135. jackie123 Lv 1 1 pt. 7,792
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 7,703
  7. Avatar for mirjamvandelft 137. mirjamvandelft Lv 1 1 pt. 7,652
  8. Avatar for Pieosaurus3 138. Pieosaurus3 Lv 1 1 pt. 7,551
  9. Avatar for Scywen 139. Scywen Lv 1 1 pt. 7,509
  10. Avatar for felipesua 140. felipesua Lv 1 1 pt. 7,456

Comments