Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,340
  2. Avatar for LociOiling 2. LociOiling Lv 1 98 pts. 9,331
  3. Avatar for dembones 3. dembones Lv 1 95 pts. 9,312
  4. Avatar for Galaxie 4. Galaxie Lv 1 93 pts. 9,311
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 90 pts. 9,309
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 88 pts. 9,285
  7. Avatar for bertro 7. bertro Lv 1 85 pts. 9,280
  8. Avatar for frood66 8. frood66 Lv 1 83 pts. 9,280
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 81 pts. 9,276
  10. Avatar for pmdpmd 10. pmdpmd Lv 1 79 pts. 9,275

Comments