Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488
  1. Avatar for senor pit 131. senor pit Lv 1 1 pt. 8,056
  2. Avatar for Anfinsen_slept_here 132. Anfinsen_slept_here Lv 1 1 pt. 8,048
  3. Avatar for justjustin 133. justjustin Lv 1 1 pt. 8,040
  4. Avatar for Savas 134. Savas Lv 1 1 pt. 8,033
  5. Avatar for Alistair69 135. Alistair69 Lv 1 1 pt. 8,019
  6. Avatar for eromana 136. eromana Lv 1 1 pt. 8,012
  7. Avatar for hapalops 137. hapalops Lv 1 1 pt. 8,010
  8. Avatar for Mark A 138. Mark A Lv 1 1 pt. 7,983
  9. Avatar for ivalnic 139. ivalnic Lv 1 1 pt. 7,949
  10. Avatar for 01010011111 140. 01010011111 Lv 1 1 pt. 7,940

Comments