Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488

  1. Avatar for cherry39 141. cherry39 Lv 1 1 pt. 7,920
  2. Avatar for Deleted player 142. Deleted player pts. 7,904
  3. Avatar for aspadistra 143. aspadistra Lv 1 1 pt. 7,902
  4. Avatar for Dantoto 144. Dantoto Lv 1 1 pt. 7,895
  5. Avatar for rezaefar 145. rezaefar Lv 1 1 pt. 7,867
  6. Avatar for jarbolol15 146. jarbolol15 Lv 1 1 pt. 7,860
  7. Avatar for momadoc 147. momadoc Lv 1 1 pt. 7,853
  8. Avatar for Ref_Jo 148. Ref_Jo Lv 1 1 pt. 7,844
  9. Avatar for Ariasmpony 149. Ariasmpony Lv 1 1 pt. 7,829
  10. Avatar for roman madala 150. roman madala Lv 1 1 pt. 7,792

Comments