Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488
  1. Avatar for jbmkfm125 161. jbmkfm125 Lv 1 1 pt. 7,539
  2. Avatar for gu14016 162. gu14016 Lv 1 1 pt. 7,519
  3. Avatar for Cerzax 163. Cerzax Lv 1 1 pt. 7,501
  4. Avatar for Dzmitryd 164. Dzmitryd Lv 1 1 pt. 7,491
  5. Avatar for Synthetic77 165. Synthetic77 Lv 1 1 pt. 7,488
  6. Avatar for doctaven 166. doctaven Lv 1 1 pt. 7,488
  7. Avatar for trentis1 167. trentis1 Lv 1 1 pt. 7,442
  8. Avatar for NotJim99 168. NotJim99 Lv 1 1 pt. 7,410
  9. Avatar for kcy0511 169. kcy0511 Lv 1 1 pt. 7,397
  10. Avatar for Kimbostu 170. Kimbostu Lv 1 1 pt. 7,353

Comments