Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488
  1. Avatar for tuxutku 171. tuxutku Lv 1 1 pt. 7,351
  2. Avatar for inkycatz 172. inkycatz Lv 1 1 pt. 7,331
  3. Avatar for AlarakDark 173. AlarakDark Lv 1 1 pt. 7,330
  4. Avatar for xplocast1 174. xplocast1 Lv 1 1 pt. 7,318
  5. Avatar for PauloRosseto 175. PauloRosseto Lv 1 1 pt. 7,275
  6. Avatar for Tyug 176. Tyug Lv 1 1 pt. 6,940
  7. Avatar for Aldrovanda 177. Aldrovanda Lv 1 1 pt. 6,887
  8. Avatar for benjy33 178. benjy33 Lv 1 1 pt. 6,731
  9. Avatar for jannafamliy 179. jannafamliy Lv 1 1 pt. 5,976
  10. Avatar for remilag 180. remilag Lv 1 1 pt. 5,778

Comments