Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488
  1. Avatar for cassandraberry81897 181. cassandraberry81897 Lv 1 1 pt. 4,069
  2. Avatar for jflat06 182. jflat06 Lv 1 1 pt. 4,069
  3. Avatar for Hollinas 183. Hollinas Lv 1 1 pt. 4,069
  4. Avatar for froggs554 184. froggs554 Lv 1 1 pt. 4,069
  5. Avatar for jwu1234567890 185. jwu1234567890 Lv 1 1 pt. 4,069
  6. Avatar for martin.szew 186. martin.szew Lv 1 1 pt. 4,069
  7. Avatar for gu14012 187. gu14012 Lv 1 1 pt. 4,069
  8. Avatar for tokens 188. tokens Lv 1 1 pt. 4,069

Comments