Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 8,746
  2. Avatar for xkcd 12. xkcd 3 pts. 8,489
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,353
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,247
  5. Avatar for freefolder 15. freefolder 1 pt. 8,079
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 8,033
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,902
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,519
  9. Avatar for Deleted group 19. Deleted group pts. 7,491
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,488

  1. Avatar for Vinara 41. Vinara Lv 1 31 pts. 9,121
  2. Avatar for Marvelz 42. Marvelz Lv 1 30 pts. 9,119
  3. Avatar for MicElephant 43. MicElephant Lv 1 29 pts. 9,116
  4. Avatar for tarimo 44. tarimo Lv 1 28 pts. 9,112
  5. Avatar for eusair 45. eusair Lv 1 27 pts. 9,104
  6. Avatar for christioanchauvin 46. christioanchauvin Lv 1 26 pts. 9,096
  7. Avatar for YeshuaLives 47. YeshuaLives Lv 1 25 pts. 9,092
  8. Avatar for Keresto 48. Keresto Lv 1 24 pts. 9,092
  9. Avatar for jobo0502 49. jobo0502 Lv 1 23 pts. 9,084
  10. Avatar for georg137 50. georg137 Lv 1 22 pts. 9,083

Comments