1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Summary

• Created: January 11, 2017
• Expires: January 18, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

• 21. Deleted group pts. 7,353
• 22. Window Group 1 pt. 4,069

Top soloists

• 1. gitwut 100 pts. 9,340
• 2. LociOiling 98 pts. 9,331
• 3. dembones 95 pts. 9,312
• 4. Galaxie 93 pts. 9,311
• 5. Bruno Kestemont 90 pts. 9,309
• 6. fiendish_ghoul 88 pts. 9,285
• 7. bertro 85 pts. 9,280
• 8. frood66 83 pts. 9,280
• 9. retiredmichael 81 pts. 9,276
• 10. pmdpmd 79 pts. 9,275