Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,335
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 9,329
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 73 pts. 9,328
  4. Avatar for reefyrob 4. reefyrob Lv 1 62 pts. 9,326
  5. Avatar for dembones 5. dembones Lv 1 52 pts. 9,321
  6. Avatar for martin.szew 6. martin.szew Lv 1 43 pts. 9,320
  7. Avatar for Galaxie 7. Galaxie Lv 1 36 pts. 9,311
  8. Avatar for phi16 8. phi16 Lv 1 30 pts. 9,310
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 24 pts. 9,309
  10. Avatar for Hollinas 10. Hollinas Lv 1 20 pts. 9,308

Comments