Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,340
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,331
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,311
  4. Avatar for Go Science 4. Go Science 47 pts. 9,309
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,284
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,275
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 9,248
  8. Avatar for Kotocycle 8. Kotocycle 14 pts. 9,228
  9. Avatar for Deleted group 9. Deleted group pts. 9,033
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,003
  1. Avatar for ManVsYard 21. ManVsYard Lv 1 1 pt. 9,284
  2. Avatar for Fat Tony 22. Fat Tony Lv 1 1 pt. 9,283
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 1 pt. 9,283
  4. Avatar for mimi 24. mimi Lv 1 1 pt. 9,278
  5. Avatar for alwen 25. alwen Lv 1 1 pt. 9,264
  6. Avatar for jfryk 26. jfryk Lv 1 1 pt. 9,261
  7. Avatar for Keresto 27. Keresto Lv 1 1 pt. 9,237
  8. Avatar for actiasluna 28. actiasluna Lv 1 1 pt. 9,232
  9. Avatar for Norrjane 29. Norrjane Lv 1 1 pt. 9,231
  10. Avatar for retiredmichael 30. retiredmichael Lv 1 1 pt. 9,115

Comments