Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Contenders 100 pts. 9,340
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,331
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,311
  4. Avatar for Go Science 4. Go Science 47 pts. 9,309
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,284
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,275
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 9,248
  8. Avatar for Kotocycle 8. Kotocycle 14 pts. 9,228
  9. Avatar for Deleted group 9. Deleted group pts. 9,033
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,003

  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 3 pts. 8,402
  2. Avatar for Simek 102. Simek Lv 1 3 pts. 8,391
  3. Avatar for joaniegirl 103. joaniegirl Lv 1 2 pts. 8,375
  4. Avatar for stephen.r.lewis86 104. stephen.r.lewis86 Lv 1 2 pts. 8,375
  5. Avatar for DScott 105. DScott Lv 1 2 pts. 8,363
  6. Avatar for Mr_Jolty 106. Mr_Jolty Lv 1 2 pts. 8,353
  7. Avatar for weitzen 107. weitzen Lv 1 2 pts. 8,332
  8. Avatar for jfryk 108. jfryk Lv 1 2 pts. 8,330
  9. Avatar for manu8170 109. manu8170 Lv 1 2 pts. 8,288
  10. Avatar for drising 110. drising Lv 1 2 pts. 8,282

Comments