Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275
  1. Avatar for jfryk 91. jfryk Lv 1 3 pts. 8,377
  2. Avatar for JUMELLE54 92. JUMELLE54 Lv 1 3 pts. 8,376
  3. Avatar for SaraL 93. SaraL Lv 1 2 pts. 8,370
  4. Avatar for eromana 94. eromana Lv 1 2 pts. 8,357
  5. Avatar for Imeturoran 95. Imeturoran Lv 1 2 pts. 8,354
  6. Avatar for katling 96. katling Lv 1 2 pts. 8,351
  7. Avatar for Alistair69 97. Alistair69 Lv 1 2 pts. 8,350
  8. Avatar for Formula350 98. Formula350 Lv 1 2 pts. 8,344
  9. Avatar for gmn 99. gmn Lv 1 2 pts. 8,334
  10. Avatar for andrewxc 100. andrewxc Lv 1 2 pts. 8,327

Comments