Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275
  1. Avatar for Germes 131. Germes Lv 1 1 pt. 7,910
  2. Avatar for rezaefar 132. rezaefar Lv 1 1 pt. 7,893
  3. Avatar for altejoh 133. altejoh Lv 1 1 pt. 7,855
  4. Avatar for cnhrcolemam 134. cnhrcolemam Lv 1 1 pt. 7,849
  5. Avatar for ZiiONIC 135. ZiiONIC Lv 1 1 pt. 7,828
  6. Avatar for bergie72 136. bergie72 Lv 1 1 pt. 7,789
  7. Avatar for trentis1 137. trentis1 Lv 1 1 pt. 7,767
  8. Avatar for alrianne 138. alrianne Lv 1 1 pt. 7,758
  9. Avatar for Datstandin 139. Datstandin Lv 1 1 pt. 7,744
  10. Avatar for Savas 140. Savas Lv 1 1 pt. 7,732

Comments