Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275

  1. Avatar for parsnip 141. parsnip Lv 1 1 pt. 7,719
  2. Avatar for Hollinas 142. Hollinas Lv 1 1 pt. 7,683
  3. Avatar for TePie 143. TePie Lv 1 1 pt. 7,680
  4. Avatar for Deleted player 144. Deleted player pts. 7,675
  5. Avatar for BWeber 145. BWeber Lv 1 1 pt. 7,672
  6. Avatar for aspadistra 146. aspadistra Lv 1 1 pt. 7,647
  7. Avatar for etuttle.chem463 147. etuttle.chem463 Lv 1 1 pt. 7,627
  8. Avatar for TomTaylor 148. TomTaylor Lv 1 1 pt. 7,609
  9. Avatar for jwu1234567890 149. jwu1234567890 Lv 1 1 pt. 7,603
  10. Avatar for doctaven 150. doctaven Lv 1 1 pt. 7,600

Comments