Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275
  1. Avatar for 01010011111 161. 01010011111 Lv 1 1 pt. 7,321
  2. Avatar for mahayes 162. mahayes Lv 1 1 pt. 7,200
  3. Avatar for bakuhatsuu 163. bakuhatsuu Lv 1 1 pt. 7,092
  4. Avatar for royle 164. royle Lv 1 1 pt. 7,018
  5. Avatar for benrh 165. benrh Lv 1 1 pt. 6,911
  6. Avatar for thegrizz 166. thegrizz Lv 1 1 pt. 6,847
  7. Avatar for Brainiac_2017 167. Brainiac_2017 Lv 1 1 pt. 5,275
  8. Avatar for thebioguy 168. thebioguy Lv 1 1 pt. 5,275
  9. Avatar for metafolder 169. metafolder Lv 1 1 pt. 5,275

Comments