Foldit

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Summary

Created: January 18, 2017
Expires: January 25, 2017 at 18:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC