Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 8,955
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 8,947
  3. Avatar for Contenders 3. Contenders 60 pts. 8,934
  4. Avatar for Go Science 4. Go Science 45 pts. 8,904
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,879
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,878
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 8,831
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 8,760
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 8,617
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,613

  1. Avatar for a.smith25 151. a.smith25 Lv 1 1 pt. 7,597
  2. Avatar for Dantoto 152. Dantoto Lv 1 1 pt. 7,594
  3. Avatar for 64SciOne 153. 64SciOne Lv 1 1 pt. 7,586
  4. Avatar for Ciccillo 154. Ciccillo Lv 1 1 pt. 7,563
  5. Avatar for iceslayer 155. iceslayer Lv 1 1 pt. 7,561
  6. Avatar for 3966437 156. 3966437 Lv 1 1 pt. 7,560
  7. Avatar for heyubob 157. heyubob Lv 1 1 pt. 7,531
  8. Avatar for noforgiven 158. noforgiven Lv 1 1 pt. 7,425
  9. Avatar for chipmunk101 159. chipmunk101 Lv 1 1 pt. 7,393
  10. Avatar for Mrma94 160. Mrma94 Lv 1 1 pt. 7,356

Comments