Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 8,955
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 8,947
  3. Avatar for Contenders 3. Contenders 60 pts. 8,934
  4. Avatar for Go Science 4. Go Science 45 pts. 8,904
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,879
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,878
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 8,831
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 8,760
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 8,617
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,613

  1. Avatar for Simek 61. Simek Lv 1 11 pts. 8,607
  2. Avatar for eusair 62. eusair Lv 1 11 pts. 8,605
  3. Avatar for cobaltteal 63. cobaltteal Lv 1 10 pts. 8,603
  4. Avatar for JayD7217 64. JayD7217 Lv 1 10 pts. 8,599
  5. Avatar for jobo0502 65. jobo0502 Lv 1 10 pts. 8,580
  6. Avatar for gurch 66. gurch Lv 1 9 pts. 8,578
  7. Avatar for phi16 67. phi16 Lv 1 9 pts. 8,562
  8. Avatar for Merf 68. Merf Lv 1 8 pts. 8,556
  9. Avatar for diamonddays 69. diamonddays Lv 1 8 pts. 8,549
  10. Avatar for isaksson 70. isaksson Lv 1 8 pts. 8,548

Comments