Placeholder image of a protein
Icon representing a puzzle

1337: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 02, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 3 pts. 8,161
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,140
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,639
  4. Avatar for Deleted group 14. Deleted group pts. 7,604
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,580
  6. Avatar for freefolder 16. freefolder 1 pt. 7,515
  7. Avatar for WA HBio 2017 17. WA HBio 2017 1 pt. 7,453
  8. Avatar for The Reach Free School 18. The Reach Free School 1 pt. 7,388
  9. Avatar for Deleted group 19. Deleted group pts. 5,415
  10. Avatar for Deleted group 20. Deleted group pts. 5,415

  1. Avatar for folderredlof 131. folderredlof Lv 1 1 pt. 7,772
  2. Avatar for badgoes 133. badgoes Lv 1 1 pt. 7,759
  3. Avatar for Merf 134. Merf Lv 1 1 pt. 7,758
  4. Avatar for paulcianci 135. paulcianci Lv 1 1 pt. 7,756
  5. Avatar for momadoc 136. momadoc Lv 1 1 pt. 7,740
  6. Avatar for heyubob 137. heyubob Lv 1 1 pt. 7,739
  7. Avatar for jup 138. jup Lv 1 1 pt. 7,690
  8. Avatar for trentis1 139. trentis1 Lv 1 1 pt. 7,674
  9. Avatar for katling 140. katling Lv 1 1 pt. 7,664

Comments


frood66 Lv 1

and it certainly is recurrent.

I wonder how many times the same issue has to appear B4 the fix is done when the puzzle is posted.

Even when the puzzle is posted late.

Skippysk8s Lv 1

glad we have the same weekend special again. Can we have a new one next weekend please. Only good thing is that I will be top 10 on 1335 this weekend LOL. Also, totally unranked on 1337.

Skippysk8s Lv 1

Bruno – of course it would be different. Question right now is do you want points or a science answer. Your recipe works fine

Bruno Kestemont Lv 1

This is like a semi-disordered protein.
Reading this paper in Forum (http://fold.it/portal/node/2003337) I'm wondering if we would have more chance to find (with Foldit points) a better possible "structure" if the context (molecule or other protein) were given.
May be a question for Science Chat instead.