Placeholder image of a protein
Icon representing a puzzle

1337: Revisiting Puzzle 87: Zinc Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 02, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 8,571
  2. Avatar for Go Science 2. Go Science 77 pts. 8,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 8,523
  4. Avatar for Contenders 4. Contenders 43 pts. 8,522
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 8,480
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,445
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,441
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 8,378
  9. Avatar for xkcd 9. xkcd 7 pts. 8,305
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,188

  1. Avatar for tokens 11. tokens Lv 1 75 pts. 8,483
  2. Avatar for frood66 12. frood66 Lv 1 73 pts. 8,481
  3. Avatar for Blipperman 13. Blipperman Lv 1 71 pts. 8,478
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 69 pts. 8,477
  5. Avatar for reefyrob 15. reefyrob Lv 1 67 pts. 8,473
  6. Avatar for jfryk 16. jfryk Lv 1 65 pts. 8,448
  7. Avatar for randomlil 17. randomlil Lv 1 63 pts. 8,448
  8. Avatar for kabubi 18. kabubi Lv 1 61 pts. 8,445
  9. Avatar for nicobul 19. nicobul Lv 1 59 pts. 8,441
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 57 pts. 8,438

Comments


frood66 Lv 1

and it certainly is recurrent.

I wonder how many times the same issue has to appear B4 the fix is done when the puzzle is posted.

Even when the puzzle is posted late.

Skippysk8s Lv 1

glad we have the same weekend special again. Can we have a new one next weekend please. Only good thing is that I will be top 10 on 1335 this weekend LOL. Also, totally unranked on 1337.

Skippysk8s Lv 1

Bruno – of course it would be different. Question right now is do you want points or a science answer. Your recipe works fine

Bruno Kestemont Lv 1

This is like a semi-disordered protein.
Reading this paper in Forum (http://fold.it/portal/node/2003337) I'm wondering if we would have more chance to find (with Foldit points) a better possible "structure" if the context (molecule or other protein) were given.
May be a question for Science Chat instead.