Placeholder image of a protein
Icon representing a puzzle

1338: Unsolved De-novo Freestyle 99

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 07, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TIVLVLERTKEEDSERFEREMKRLIKENQHTRIDIDGDGTYLIVVHNGHQEEIKKVMKEMKEHFKKTTSSEIRNQ

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,774
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 8,702
  3. Avatar for SciOne2017 13. SciOne2017 1 pt. 8,201
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,032
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,840
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 6,164
  7. Avatar for WA HBio 2017 17. WA HBio 2017 1 pt. 5,928
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  9. Avatar for Villanova ChE 19. Villanova ChE 1 pt. 0

  1. Avatar for ManVsYard
    1. ManVsYard Lv 1
    100 pts. 9,425
  2. Avatar for actiasluna 2. actiasluna Lv 1 88 pts. 9,423
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 77 pts. 9,422
  4. Avatar for Keresto 4. Keresto Lv 1 67 pts. 9,403
  5. Avatar for Fat Tony 5. Fat Tony Lv 1 58 pts. 9,395
  6. Avatar for smholst 6. smholst Lv 1 50 pts. 9,395
  7. Avatar for Norrjane 7. Norrjane Lv 1 43 pts. 9,390
  8. Avatar for SaraL 8. SaraL Lv 1 37 pts. 9,384
  9. Avatar for toshiue 9. toshiue Lv 1 31 pts. 9,369
  10. Avatar for Hollinas 10. Hollinas Lv 1 26 pts. 9,369

Comments


toshiue Lv 1

Thanks to both, DL from the web page didn't resolve. All puzzles listed as expired, but even upon refresh, list ends at 1337.

Bruno Kestemont Lv 1

In some client (under "expired puzzles"), I did not find 1338, in other well. I think I can find it with the former version but not with the updated version. To be verified.

toshiue Lv 1

former version vs updated version. suspect the same, unfortunately noticed it (inability to locate 1338) after I'd updated all clients, haven't an old version to check it against. do you more experienced folk routinely archive former versions for just such instances as this, and if so…what's the best method for doing such? (thanks)