Placeholder image of a protein
Icon representing a puzzle

1338: Unsolved De-novo Freestyle 99

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 07, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TIVLVLERTKEEDSERFEREMKRLIKENQHTRIDIDGDGTYLIVVHNGHQEEIKKVMKEMKEHFKKTTSSEIRNQ

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,425
  2. Avatar for Go Science 2. Go Science 76 pts. 9,369
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,341
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,322
  5. Avatar for Contenders 5. Contenders 29 pts. 9,301
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,164
  7. Avatar for xkcd 7. xkcd 14 pts. 9,145
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,137
  9. Avatar for Kotocycle 9. Kotocycle 6 pts. 8,947
  10. Avatar for Deleted group 10. Deleted group pts. 8,877

  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 3 pts. 8,448
  2. Avatar for Iron pet 102. Iron pet Lv 1 3 pts. 8,446
  3. Avatar for Bushman 103. Bushman Lv 1 2 pts. 8,439
  4. Avatar for altaris 104. altaris Lv 1 2 pts. 8,435
  5. Avatar for SouperGenious 105. SouperGenious Lv 1 2 pts. 8,428
  6. Avatar for gu14016 106. gu14016 Lv 1 2 pts. 8,406
  7. Avatar for Vincenzo Brancaccio 107. Vincenzo Brancaccio Lv 1 2 pts. 8,385
  8. Avatar for JayD7217 108. JayD7217 Lv 1 2 pts. 8,313
  9. Avatar for SaraL 109. SaraL Lv 1 2 pts. 8,309
  10. Avatar for dssb 110. dssb Lv 1 2 pts. 8,302

Comments


toshiue Lv 1

Thanks to both, DL from the web page didn't resolve. All puzzles listed as expired, but even upon refresh, list ends at 1337.

Bruno Kestemont Lv 1

In some client (under "expired puzzles"), I did not find 1338, in other well. I think I can find it with the former version but not with the updated version. To be verified.

toshiue Lv 1

former version vs updated version. suspect the same, unfortunately noticed it (inability to locate 1338) after I'd updated all clients, haven't an old version to check it against. do you more experienced folk routinely archive former versions for just such instances as this, and if so…what's the best method for doing such? (thanks)