Placeholder image of a protein
Icon representing a puzzle

1338: Unsolved De-novo Freestyle 99

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 07, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TIVLVLERTKEEDSERFEREMKRLIKENQHTRIDIDGDGTYLIVVHNGHQEEIKKVMKEMKEHFKKTTSSEIRNQ

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,425
  2. Avatar for Go Science 2. Go Science 76 pts. 9,369
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,341
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,322
  5. Avatar for Contenders 5. Contenders 29 pts. 9,301
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,164
  7. Avatar for xkcd 7. xkcd 14 pts. 9,145
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,137
  9. Avatar for Kotocycle 9. Kotocycle 6 pts. 8,947
  10. Avatar for Deleted group 10. Deleted group pts. 8,877
  1. Avatar for jfryk 11. jfryk Lv 1 76 pts. 9,266
  2. Avatar for Vredeman 12. Vredeman Lv 1 74 pts. 9,262
  3. Avatar for Scopper 13. Scopper Lv 1 72 pts. 9,254
  4. Avatar for Galaxie 14. Galaxie Lv 1 70 pts. 9,229
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 68 pts. 9,217
  6. Avatar for Deleted player 16. Deleted player pts. 9,204
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 64 pts. 9,194
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 63 pts. 9,182
  9. Avatar for LociOiling 19. LociOiling Lv 1 61 pts. 9,174
  10. Avatar for pauldunn 20. pauldunn Lv 1 59 pts. 9,174

Comments

toshiue Lv 1

Thanks to both, DL from the web page didn't resolve. All puzzles listed as expired, but even upon refresh, list ends at 1337.

Bruno Kestemont Lv 1

In some client (under "expired puzzles"), I did not find 1338, in other well. I think I can find it with the former version but not with the updated version. To be verified.

toshiue Lv 1

former version vs updated version. suspect the same, unfortunately noticed it (inability to locate 1338) after I'd updated all clients, haven't an old version to check it against. do you more experienced folk routinely archive former versions for just such instances as this, and if so…what's the best method for doing such? (thanks)